« Back
Home /
Recombinant Mouse IL-17A/CTLA-8 Protein

Recombinant Mouse IL-17A/CTLA-8 Protein

€415.00

Excl. VAT

Item no.	RP02520-50ug
Manufacturer	Abclonal
Amount	50 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Purity	> 98% by SDS-PAGE.
Sequence	MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
NCBI	IL-17A/CTLA-8
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CTLA-8,CTLA8cytotoxic T-lymphocyte-associated serine esterase 8,Cytotoxic T-lymphocyte-associated antigen 8,IL17,IL-17,IL17A,IL-17A,IL-17Acytotoxic T-lymphocyte-associated protein 8,IL-17CTLA-8,IL17interleukin-17A,interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8),interleukin 17A
Available
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	Interleukin-17A is a protein that in humans is encoded by the IL17A gene. The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO).
Route	C-His
Manufacturers Category	Proteins
Endotoxin	<0.1EU/μg
Storage	Store the lyophilized protein at -20°C to -80°C for long term.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area	Interleukin
Gene Symbol	IL-17A/CTLA-8
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of 20 mM sodium citrate, 0.2 M NaCl, pH 4.5.
Protein Description	Recombinant Mouse IL-17A Protein is produced by Escherichia coli expression system. The target protein is expressed with sequence of Mouse IL-17A fused with polyhistidine tag at the C-terminus
Protein Bio Activity	Measured by its ability to inhibit IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant mouse IL-17A is > 1 x 106 IU/mg.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

Listprice: €415.00

Price: €415.00

available

Delivery expected until 9/30/2025

Quantity:

Compare