« Zurück
Startseite /
Recombinant Mouse IL-17A/CTLA-8 Protein

Recombinant Mouse IL-17A/CTLA-8 Protein

415,00 €

Zzgl. MwSt.

ArtNr	RP02520-50ug
Hersteller	Abclonal
Menge	50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Purity	> 98% by SDS-PAGE.
Sequence	MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
NCBI	IL-17A/CTLA-8
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CTLA-8,CTLA8cytotoxic T-lymphocyte-associated serine esterase 8,Cytotoxic T-lymphocyte-associated antigen 8,IL17,IL-17,IL17A,IL-17A,IL-17Acytotoxic T-lymphocyte-associated protein 8,IL-17CTLA-8,IL17interleukin-17A,interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8),interleukin 17A
Lieferbar
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	Interleukin-17A is a protein that in humans is encoded by the IL17A gene. The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO).
Route	C-His
Manufacturers Category	Proteins
Endotoxin	<0.1EU/μg
Storage	Store the lyophilized protein at -20°C to -80°C for long term.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area	Interleukin
Gene Symbol	IL-17A/CTLA-8
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of 20 mM sodium citrate, 0.2 M NaCl, pH 4.5.
Protein Description	Recombinant Mouse IL-17A Protein is produced by Escherichia coli expression system. The target protein is expressed with sequence of Mouse IL-17A fused with polyhistidine tag at the C-terminus
Protein Bio Activity	Measured by its ability to inhibit IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant mouse IL-17A is > 1 x 106 IU/mg.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

Listenpreis: 415,00 €

Preis: 415,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen