Comparison

Recombinant Mouse CD40-L/CD40L/TNFSF5/TRAP/CD40LG Protein

€230.00
Excl. VAT
Item no. RP01734-50ug
Manufacturer Abclonal
Amount 50 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Sequence GDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
NCBI CD4-L/CD4L/TNFSF5/TRAP/CD4LG
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias IGM; IMD3; Ly62; TRAP; gp39; CD154; Cd40l; HIGM1; Ly-62; T-BAM; CD40-L; Tnfsf5; Tnlg8b;CD40LG
Available
Description
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background
CD154, also known as CD40 ligand or CD40L, is a member of the TNF superfamily. While CD154 was originally found on T cell surface, its expression has since been found on a wide variety of cells, including platelets, mast cells, macrophages and NK cells. CD154's ability is achieved through binding to the CD40 on antigen-presenting cells (APC). In the macrophage cells, the primary signal for activation is IFN-γ from Th1 type CD4 T cells. The secondary signal is CD40L on the T cell, which interacting with the CD40 molecules, helping increase the level of activation.
Route
N-6His
Manufacturers Category
Proteins
Endotoxin
< 0.1EU/μg
Immunogen
Gly115-Leu260
Storage
Store the lyophilized protein at -20°C to -80°C for 12 months.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area
Cytokines & Cytokine receptors
Gene Symbol
CD40-L/CD40L/TNFSF5/TRAP/CD40LG
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description
Recombinant Mouse CD40-L/CD40L/TNFSF5/TRAP/CD40LG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly115-Leu260) of mouse CD40-L/CD40L/TNFSF5/TRAP/CD40LG (Accession #NP_035746.2) fused with and a 6×His tag at the N-terminus.
Protein Bio Activity
Measured by its binding ability in a functional ELISA.Immobilized Mouse CD40L (Catalog: RP01734) at 5 μg/mL (100 μL/well) can bind Human CD40 (Catalog: RP01218) with a linear range of 0.005-1 μg/mL.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
Listprice: €230.00
Price: €230.00
available

Delivery expected until 9/30/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close