Vergleich

Recombinant Mouse CD40-L/CD40L/TNFSF5/TRAP/CD40LG Protein

230,00 €
Zzgl. MwSt.
ArtNr RP01734-50ug
Hersteller Abclonal
Menge 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Sequence GDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
NCBI CD4-L/CD4L/TNFSF5/TRAP/CD4LG
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias IGM; IMD3; Ly62; TRAP; gp39; CD154; Cd40l; HIGM1; Ly-62; T-BAM; CD40-L; Tnfsf5; Tnlg8b;CD40LG
Lieferbar
Description
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background
CD154, also known as CD40 ligand or CD40L, is a member of the TNF superfamily. While CD154 was originally found on T cell surface, its expression has since been found on a wide variety of cells, including platelets, mast cells, macrophages and NK cells. CD154's ability is achieved through binding to the CD40 on antigen-presenting cells (APC). In the macrophage cells, the primary signal for activation is IFN-γ from Th1 type CD4 T cells. The secondary signal is CD40L on the T cell, which interacting with the CD40 molecules, helping increase the level of activation.
Route
N-6His
Manufacturers Category
Proteins
Endotoxin
< 0.1EU/μg
Immunogen
Gly115-Leu260
Storage
Store the lyophilized protein at -20°C to -80°C for 12 months.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area
Cytokines & Cytokine receptors
Gene Symbol
CD40-L/CD40L/TNFSF5/TRAP/CD40LG
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description
Recombinant Mouse CD40-L/CD40L/TNFSF5/TRAP/CD40LG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly115-Leu260) of mouse CD40-L/CD40L/TNFSF5/TRAP/CD40LG (Accession #NP_035746.2) fused with and a 6×His tag at the N-terminus.
Protein Bio Activity
Measured by its binding ability in a functional ELISA.Immobilized Mouse CD40L (Catalog: RP01734) at 5 μg/mL (100 μL/well) can bind Human CD40 (Catalog: RP01218) with a linear range of 0.005-1 μg/mL.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
Listenpreis: 230,00 €
Preis: 230,00 €
lieferbar

Lieferung vsl. bis 30.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen