« Back
Home /
Recombinant Human Follicle Stimulating Hormone (FSH)（CGA&FSHB） Protein

Recombinant Human Follicle Stimulating Hormone (FSH)（CGA&FSHB） Protein

€135.00

Excl. VAT

Item no.	RP01695-20ug
Manufacturer	Abclonal
Amount	20 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 97% by SDS-PAGE.
Sequence	APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
NCBI	Follicle Stimulating Hormone (FSH)（CGA&FSHB）
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HCG; LHA; FSHA; GPA1; GPHa; TSHA; GPHA1; CG-ALPHA&HH24，CGA&FSHB；Follicle Stimulating Hormone (FSH)（CGA&FSHB）
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	Follicle-stimulating hormone (FSH) is a gonadotrope-derived heterodimeric glycoprotein. FSH plays an essential role in processes involved in human reproduction, including spermatogenesis and the ovarian cycle. FSHB represents a conservative vertebrate gene with a unique function and it is located in a structurally stable gene-poor region. Polymorphisms in the follicle stimulating hormone beta subunit (FSHB) and follicle stimulating hormone receptor (FSHR) genes might disturb normal spermatogenesis and affect male reproductive ability. The FSHB -211G>T genotype is a key determinant in the regulation of gonadotropins in different reproductive-endocrine pathopyhsiologies.
Route	C-His(CGA)&No tag(SHB)
Manufacturers Category	Proteins
Endotoxin	<0.1EU/μg
Immunogen	Ala 25-Ser116＆Asn19-Glu129
Storage	Store the lyophilized protein at -20°C to -80°C for 12 months.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area	Other Recombinant Protein
Gene Symbol	Follicle Stimulating Hormone (FSH)
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description	Recombinant Human Follicle Stimulating Hormone (FSH) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala 25-Ser116＆Asn19-Glu129) of human Follicle Stimulating Hormone (FSH) (Accession #NP_000726.1＆NP_000501.1) fused with and a 6×His tag at the C-terminus(CGA).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

Listprice: €135.00

Price: €135.00

available

Delivery expected until 9/30/2025

Quantity:

Compare