« Zurück
Startseite /
Recombinant Human Follicle Stimulating Hormone (FSH)（CGA&FSHB） Protein

Recombinant Human Follicle Stimulating Hormone (FSH)（CGA&FSHB） Protein

135,00 €

Zzgl. MwSt.

ArtNr	RP01695-20ug
Hersteller	Abclonal
Menge	20 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 97% by SDS-PAGE.
Sequence	APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
NCBI	Follicle Stimulating Hormone (FSH)（CGA&FSHB）
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HCG; LHA; FSHA; GPA1; GPHa; TSHA; GPHA1; CG-ALPHA&HH24，CGA&FSHB；Follicle Stimulating Hormone (FSH)（CGA&FSHB）
Lieferbar
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	Follicle-stimulating hormone (FSH) is a gonadotrope-derived heterodimeric glycoprotein. FSH plays an essential role in processes involved in human reproduction, including spermatogenesis and the ovarian cycle. FSHB represents a conservative vertebrate gene with a unique function and it is located in a structurally stable gene-poor region. Polymorphisms in the follicle stimulating hormone beta subunit (FSHB) and follicle stimulating hormone receptor (FSHR) genes might disturb normal spermatogenesis and affect male reproductive ability. The FSHB -211G>T genotype is a key determinant in the regulation of gonadotropins in different reproductive-endocrine pathopyhsiologies.
Route	C-His(CGA)&No tag(SHB)
Manufacturers Category	Proteins
Endotoxin	<0.1EU/μg
Immunogen	Ala 25-Ser116＆Asn19-Glu129
Storage	Store the lyophilized protein at -20°C to -80°C for 12 months.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area	Other Recombinant Protein
Gene Symbol	Follicle Stimulating Hormone (FSH)
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description	Recombinant Human Follicle Stimulating Hormone (FSH) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala 25-Ser116＆Asn19-Glu129) of human Follicle Stimulating Hormone (FSH) (Accession #NP_000726.1＆NP_000501.1) fused with and a 6×His tag at the C-terminus(CGA).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

Listenpreis: 135,00 €

Preis: 135,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen