« Back
Home /
Recombinant Mouse B7-H5/Gi24/VISTA Protein

Recombinant Mouse B7-H5/Gi24/VISTA Protein

€660.00

Excl. VAT

Item no.	RP01328-500ug
Manufacturer	Abclonal
Amount	500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Host	Mouse
Purity	> 95% by SDS-PAGE.
Sequence	FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNF TLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKN HHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAA
NCBI	B7-H5/Gi24/VISTA
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	VSIR, V-Set Immunoregulatory Receptor, also known as VISTA, is an immunoregulatory receptor that inhibits the T-cell response. It may promote differentiation of embryonic stem cells, by inhibiting BMP4 signaling. VSIR, or V-set immunoregulatory receptor, could be involved in the pathogenesis of chronic rhinosinusitis with nasal polyps. V-domain Immunoglobulin Suppressor of T cell Activation (VISTA) is an inhibitory immune-checkpoint molecule that suppresses CD4+ and CD8+ T cell activation when expressed on antigen-presenting cells. VSIR is broadly expressed in the spleen, bone marrow, and other tissues. Diseases associated with VSIR include Ichthyosis, Congenital, Autosomal Recessive 6, and Monckeberg Arteriosclerosis.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Phe33-Ala191
Storage	Store the lyophilized protein at -20°C to -80°C for long term.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area	Other Recombinant Protein
Gene Symbol	B7-H5/Gi24/VISTA
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description	Recombinant Mouse B7-H5/Gi24/VISTA Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe33 - Ala191) of Mouse VISTA (Accession #NP_083008.1) fused with an 6×His tag at the C-terminus.
Protein Bio Activity	Measured by its binding ability in a functional ELISA.Immobilized Mouse B7-H5/VISTA (Catalog: RP01328) at 0.5 μg/mL (100 μL/well) can bind B7-H5/VISTA Rabbit pAb with a linear range of 0.01-2.6 ng/mL.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

Listprice: €660.00

Price: €660.00

available

Delivery expected until 9/30/2025

Quantity:

Compare