« Back
Home /
Recombinant HCoV-OC43 Coronavirus Hemagglutinin esterase Protein with His tag

Recombinant HCoV-OC43 Coronavirus Hemagglutinin esterase Protein with His tag

€75.00

Excl. VAT

Item no.	RP01301LQ-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	HCoV-OC43
Purity	> 95% by SDS-PAGE.
Dry ice	Yes
Sequence	LGFYNPPTNVVSHVNGDWFLFGDSRSDCNHIVNINPHNYSYMDLNPVLCDSGKISSKAGNSIFRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCNRSGSNDIWMQNKGLFYTQVYKNMAVYRSLTFVNVPYVYNGSAQATALCKSGSLVLNNPAYIAPQANSGDYYYKVEADFYLSGCDEYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDLNCYYLVLPSGNYLAISNELLLTVP
NCBI	HCoV-OC43 Hemagglutinin esterase/HE
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Species	HCoV-OC43
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Leu17-Val392
Storage	This product is stable at ≤ -70°C for up to 1 year from the date of receipt.\|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Manufacturers Research Area	Coronavirus antigens
Gene Symbol	HCoV-OC43 Hemagglutinin esterase/HE
Protein Formulation	Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.
Protein Description	Recombinant HCoV-OC43 Coronavirus Hemagglutinin esterase Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu17-Val392) of hcov-oc43 Coronavirus Hemagglutinin esterase (Accession #YP_009555240.1) fused with a 6×His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

Listprice: €75.00

Price: €75.00

available

Delivery expected until 9/30/2025

Quantity:

Compare