« Back
Home /
Recombinant SARS-CoV-2 papain-like protease with His tag

Recombinant SARS-CoV-2 papain-like protease with His tag

€1,975.00

Excl. VAT

Item no.	RP01274LQ-1mg
Manufacturer	Abclonal
Amount	1 mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	SARS-CoV-2
Host	SARS-CoV-2
Purity	> 90% by SDS-PAGE.
Dry ice	Yes
Sequence	EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKH
NCBI	SARS-CoV-2 papain-like protease
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Route	N-His
Manufacturers Category	Proteins
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Immunogen	Glu1564-Lys1878
Storage	This product is stable at ≤ -70°C for up to 1 year from the date of receipt.\|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.Avoid repeated freeze-thaw cycles.
Protein Size	36.6kDa
Manufacturers Research Area	SARS-CoV-2 antigens
Gene Symbol	SARS-CoV-2 papain-like protease
Protein Formulation	Supplied as a 0.22 μm filtered solution in 20mM Tris, 20% Glycerol, 10mM β-Me，pH7.5.Contact us for customized product form or formulation.
Protein Description	Recombinant SARS-CoV-2(2019-nCoV) papain-like protease is produced by E. coli expression system. The target protein is expressed with sequence (Glu1564-Lys1878) of SARS-COV-2(2019-nCoV) papain-like protease (Accession #YP_009725299.1) fused with an initial Met, a 6×His tag at the N-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

Listprice: €1,975.00

Price: €1,975.00

available

Delivery expected until 9/30/2025

Quantity:

Compare