« Zurück
Startseite /
Recombinant SARS-CoV-2 papain-like protease with His tag

Recombinant SARS-CoV-2 papain-like protease with His tag

1.975,00 €

Zzgl. MwSt.

ArtNr	RP01274LQ-1mg
Hersteller	Abclonal
Menge	1 mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	SARS-CoV-2
Host	SARS-CoV-2
Purity	> 90% by SDS-PAGE.
Dry ice	Yes
Sequence	EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKH
NCBI	SARS-CoV-2 papain-like protease
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Route	N-His
Manufacturers Category	Proteins
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Immunogen	Glu1564-Lys1878
Storage	This product is stable at ≤ -70°C for up to 1 year from the date of receipt.\|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.Avoid repeated freeze-thaw cycles.
Protein Size	36.6kDa
Manufacturers Research Area	SARS-CoV-2 antigens
Gene Symbol	SARS-CoV-2 papain-like protease
Protein Formulation	Supplied as a 0.22 μm filtered solution in 20mM Tris, 20% Glycerol, 10mM β-Me，pH7.5.Contact us for customized product form or formulation.
Protein Description	Recombinant SARS-CoV-2(2019-nCoV) papain-like protease is produced by E. coli expression system. The target protein is expressed with sequence (Glu1564-Lys1878) of SARS-COV-2(2019-nCoV) papain-like protease (Accession #YP_009725299.1) fused with an initial Met, a 6×His tag at the N-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

Listenpreis: 1.975,00 €

Preis: 1.975,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen