« Back
Home /
Recombinant SARS-CoV-2 Spike S2 ECD Protein with His tag

Recombinant SARS-CoV-2 Spike S2 ECD Protein with His tag

€2,295.00

Excl. VAT

Item no.	RP01267-1mg
Manufacturer	Abclonal
Amount	1 mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	SARS-CoV-2
Host	SARS-CoV-2
Purity	> 90% by SDS-PAGE.
Sequence	SVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSS
NCBI	SARS-CoV-2 Spike S2 ECD
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Immunogen	Ser686-Pro1213
Storage	Store the lyophilized protein at -20°C to -80 °C for long term.\|After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.\|or This product is stable at ≤ -70°C for up to 6 months from the date of receipt. \|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Protein Size	58.8kDa
Manufacturers Research Area	SARS-CoV-2 antigens
Gene Symbol	SARS-CoV-2 Spike S2 ECD
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of sterile 20 mM PB, 300 mM NaCl, pH 7.0. or Supplied as a 0.22 μm filtered solution in 20 mM PB, 300 mM NaCl, pH 7.0Contact us for customized product form or formulation.
Protein Description	Recombinant SARS-CoV-2(2019-nCoV) Spike S2 ECD Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Ser686-Pro1213) of SARS-COV-2(2019-nCoV) Spike S2 ECD (Accession #YP_009724390.1) fused with a His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

Listprice: €2,295.00

Price: €2,295.00

available

Delivery expected until 9/30/2025

Quantity:

Compare