« Zurück
Startseite /
Recombinant SARS-CoV-2 Spike S2 ECD Protein with His tag

Recombinant SARS-CoV-2 Spike S2 ECD Protein with His tag

2.295,00 €

Zzgl. MwSt.

ArtNr	RP01267-1mg
Hersteller	Abclonal
Menge	1 mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	SARS-CoV-2
Host	SARS-CoV-2
Purity	> 90% by SDS-PAGE.
Sequence	SVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSS
NCBI	SARS-CoV-2 Spike S2 ECD
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Immunogen	Ser686-Pro1213
Storage	Store the lyophilized protein at -20°C to -80 °C for long term.\|After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.\|or This product is stable at ≤ -70°C for up to 6 months from the date of receipt. \|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Protein Size	58.8kDa
Manufacturers Research Area	SARS-CoV-2 antigens
Gene Symbol	SARS-CoV-2 Spike S2 ECD
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of sterile 20 mM PB, 300 mM NaCl, pH 7.0. or Supplied as a 0.22 μm filtered solution in 20 mM PB, 300 mM NaCl, pH 7.0Contact us for customized product form or formulation.
Protein Description	Recombinant SARS-CoV-2(2019-nCoV) Spike S2 ECD Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Ser686-Pro1213) of SARS-COV-2(2019-nCoV) Spike S2 ECD (Accession #YP_009724390.1) fused with a His tag at the C-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

Listenpreis: 2.295,00 €

Preis: 2.295,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen