« Back
Home /
Recombinant human FAP Protein

Recombinant human FAP Protein

€160.00

Excl. VAT

Item no.	RP01252LQ-20ug
Manufacturer	Abclonal
Amount	20 ug
Category	Oncology Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism By Cell Type Carcinoma Melanoma Sarcoma Peptides & Proteins Recombinant Proteins Enzymes Other Fatty Acid Enzymes
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Dry ice	Yes
Sequence	RPSRVHNSEENTMRALTLKDILNGTFSYKTFFPNWISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSKLWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYGDEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEVP
NCBI	Prolyl endopeptidase FAP
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DPPIV, DPPIVA, FAPA, Fibroblast Activation Protein alpha, SIMP
Similar products	FAPA, DPPIV, SIMP, DPPIVA, Fibroblast Activation Protein alpha
Available
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Arg27-Asp760
Storage	This product is stable at ≤ ‑70°C for up to 1 year from the date of receipt.\|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Manufacturers Research Area	Biosimilar Drug Targets
Gene Symbol	Prolyl endopeptidase FAP
Protein Formulation	Supplied as a 0.22 μm filtered solution in 16mM Tris, 240mM Nacl and 20% glycerol, pH7.5.Contact us for customized product form or formulation.
Protein Description	Recombinant Human Prolyl endopeptidase FAP Protein is produced by Baculovirus-Infected Sf9 Cells expression system. The target protein is expressed with sequence (Arg27-Asp760) of human FAP (Accession #NP_004451.2) fused with a 6×His tag at the C-terminus.
Protein Bio Activity	1.Measured by its binding ability in a functional ELISA. Immobilized Human FAP at 1 μg/mL (100 μL/well) can bind FAP Rabbit mAb with a linear range of 0.03-1.77 ng/mL.\|2.Measured by its ability to convert the substrate benzyloxycarbonyl-Gly-Pro-7-amido-4-methylcoumarin (Z-GP-AMC) to Z-Gly-Pro and 7-amino-4-methylcoumarin (AMC).The specific activity is >2314 pmol/min/μg.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01252LQ-20ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

Listprice: €160.00

Price: €160.00

available

Delivery expected until 9/30/2025

Quantity:

Compare