Vergleich

Recombinant human FAP Protein

160,00 €
Zzgl. MwSt.
ArtNr RP01252LQ-20ug
Hersteller Abclonal
Menge 20 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
Dry ice Yes
Sequence RPSRVHNSEENTMRALTLKDILNGTFSYKTFFPNWISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSKLWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYGDEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEVP
NCBI Prolyl endopeptidase FAP
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias DPPIV, DPPIVA, FAPA, Fibroblast Activation Protein alpha, SIMP
Similar products FAPA, DPPIV, SIMP, DPPIVA, Fibroblast Activation Protein alpha
Lieferbar
Route
C-His
Manufacturers Category
Proteins
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Immunogen
Arg27-Asp760
Storage
This product is stable at ≤ ‑70°C for up to 1 year from the date of receipt.|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Manufacturers Research Area
Biosimilar Drug Targets
Gene Symbol
Prolyl endopeptidase FAP
Protein Formulation
Supplied as a 0.22 μm filtered solution in 16mM Tris, 240mM Nacl and 20% glycerol, pH7.5.Contact us for customized product form or formulation.
Protein Description
Recombinant Human Prolyl endopeptidase FAP Protein is produced by Baculovirus-Infected Sf9 Cells expression system. The target protein is expressed with sequence (Arg27-Asp760) of human FAP (Accession #NP_004451.2) fused with a 6×His tag at the C-terminus.
Protein Bio Activity
1.Measured by its binding ability in a functional ELISA. Immobilized Human FAP at 1 μg/mL (100 μL/well) can bind FAP Rabbit mAb with a linear range of 0.03-1.77 ng/mL.|2.Measured by its ability to convert the substrate benzyloxycarbonyl-Gly-Pro-7-amido-4-methylcoumarin (Z-GP-AMC) to Z-Gly-Pro and 7-amino-4-methylcoumarin (AMC).The specific activity is >2314 pmol/min/μg.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20 ug
Lieferbar: In stock
Listenpreis: 160,00 €
Preis: 160,00 €
lieferbar

Lieferung vsl. bis 30.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen