« Back
Home /
Recombinant human B7-H2/ICOSLG Protein

Recombinant human B7-H2/ICOSLG Protein

€75.00

Excl. VAT

Item no.	RP01163-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Molecular Targets for Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins Neurodegeneration Markers;Research Area Neuroinflammation
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 90% by SDS-PAGE.
Sequence	DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS
NCBI	B7-H2/ICOSLG/CD275
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ICOSLG, B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, LICOS, ICOS ligand
Similar products	ICOSLG, B7H2, B7RP1, ICOSL, ICOS ligand, CD275, B7-H2, B7RP-1, GL50, ICOS-L, LICOS
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Asp19-Ser258
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Immune Checkpoint, Bio-Markers & CD Antigens, Biosimilar Drug Targets
Gene Symbol	B7-H2/ICOSLG/CD275
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human B7-H2/ICOSLG/CD275 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp19-Ser258) of human B7-H2/ICOSLG (Accession #NP_056074.1) fused with a 6×His tag at the C-terminus.
Protein Bio Activity	Measured by its binding ability in a functional ELISA. Immobilized Human B7-H2/ICOSLG at 1 μg/mL (100 μL/well) can bind Human ICOS/CD278 with a linear range of 2-14.8 ng/mL.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

Listprice: €75.00

Price: €75.00

available

Delivery expected until 9/30/2025

Quantity:

Compare