« Back
Home /
Recombinant Human CD70 Protein

Recombinant Human CD70 Protein

€120.00

Excl. VAT

Item no.	RP01129-50ug
Manufacturer	Abclonal
Amount	50 ug
Category	Oncology By Cell Type Carcinoma Hematology Lymphoma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 90 % by SDS-PAGE.
Sequence	QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
NCBI	TNFSF7/CD27 Ligand
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD27L, CD27LG, TNFSF7, CD70
Similar products	CD70, CD27L, CD27LG, TNFSF7
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	This protein is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.
Route	N-hFc
Manufacturers Category	Proteins
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Immunogen	Gln39-Pro193
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Immune Checkpoint, CAR-T Cell Therapy Targets, Bio-Markers & CD Antigens, TNF family, Biosimilar Drug Targets
Gene Symbol	TNFSF7/CD27 Ligand
Protein Formulation	Lyophilized from a 0.22 μm filtered solution PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human TNFSF7/CD27 Ligand Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln39-Pro193) of human CD70 (Accession #NP_001243.1) fused with an Fc tag at the N-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

Listprice: €120.00

Price: €120.00

available

Delivery expected until 9/30/2025

Quantity:

Compare