« Back
Home /
Recombinant Human Galectin-9/LGALS9 Protein

Recombinant Human Galectin-9/LGALS9 Protein

€75.00

Excl. VAT

Item no.	RP01046-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion
Type	Proteins
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 92% by SDS-PAGE.
Sequence	AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWG
NCBI	Galectin-9/LGALS9
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route	N-His
Manufacturers Category	Proteins
Immunogen	Ala2-Thr323
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Immune Checkpoint
Gene Symbol	Galectin-9/LGALS9
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human Galectin-9/LGALS9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala2-Thr323) of human Galectin-9/LGALS9 (Accession #NP_002299.2) fused with a 6×His tag at the N-terminus.
Protein Bio Activity	1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Galectin-9 at 2 μg/mL can bind Recombinant Human TIM-3 with a linear range of 5-15 μg/mL.\|2.Measured by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. When 8×104 cells/well are added to LGALS9 coated plates (5 μg/mL and 100 μL/well) in the ppresence of 10μg/ml PHA, approximately 70-80% cells will adhere specifically after 60 minutes at 37℃.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

Listprice: €75.00

Price: €75.00

available

Delivery expected until 9/2/2025

Quantity:

Compare