« Back
Home /
Recombinant Human CTLA-4 Protein

Recombinant Human CTLA-4 Protein

€90.00

Excl. VAT

Item no.	RP01044-50ug
Manufacturer	Abclonal
Amount	50 ug
Category	Oncology By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 90% by SDS-PAGE.
Sequence	AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF
NCBI	CTLA-4/CD152
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ALPS5, CD, CD152, CELIAC3, CTLA-4, GRD4, GSE, IDDM12
Similar products	CD152, CTLA-4, CD, CELIAC3, GRD4, GSE, IDDM12, ALPS5
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Immunogen	Ala37-Phe162
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Immune Checkpoint, Bio-Markers & CD Antigens, Biosimilar Drug Targets
Gene Symbol	CTLA-4/CD152
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human CTLA-4/CD152 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala37-Phe162) of human CTLA-4 (Accession #NP_005205.2) fused with a 6×His tag at the C-terminus.
Protein Bio Activity	Measured by its binding ability in a functional ELISA. Immobilized lpilimumab at 1 μg/mL (100 μL/well) can bind Recombinant Human CTLA-4 with a linear range of 6-18 ng/mL.\|2.Measured by its binding ability in a functional ELISA.Immobilized PE anti-human CD152 (CTLA-4) Antibody at 1μg/mL (25 μL/well) can bind Human CTLA-4 with a linear range of 0.46-2.05 ng/mL.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

Listprice: €90.00

Price: €90.00

available

Delivery expected until 9/30/2025

Quantity:

Compare