« Back
Home /
Recombinant Human FGF-7/KGF Protein

Recombinant Human FGF-7/KGF Protein

€2,755.00

Excl. VAT

Item no.	RP00908-1000ug
Manufacturer	Abclonal
Amount	1000 ug
Category	Oncology By Cell Type Carcinoma Hematology Myeloma Peptides & Proteins Recombinant Proteins Cell Biology Cytoskeleton Intermediate filaments
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
NCBI	FGF-7/HBGF-7
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fibroblast growth factor 7, FGF-7, Heparin-binding growth factor 7, HBGF-7, Keratinocyte growth factor, FGF7, KGF
Similar products	FGF7, KGF, HBGF-7, FGF-7, Fibroblast growth factor 7, Keratinocyte growth factor, Heparin-binding growth factor 7
Available
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Route	No tag
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Cys32-Thr194
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Growth Factor
Gene Symbol	FGF-7/HBGF-7
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, pH8.0, l50mM NaCl.Contact us for customized product form or formulation.
Protein Description	Recombinant Human FGF-7/HBGF-7 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys32-Thr194) of human FGF-7/KGF (Accession #P21781).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 ug

Listprice: €2,755.00

Price: €2,755.00

available

Delivery expected until 9/30/2025

Quantity:

Compare