« Zurück
Startseite /
Recombinant Human FGF-7/KGF Protein

Recombinant Human FGF-7/KGF Protein

2.755,00 €

Zzgl. MwSt.

ArtNr	RP00908-1000ug
Hersteller	Abclonal
Menge	1000 ug
Kategorie	Oncology By Cell Type Carcinoma Hematology Myeloma Peptides & Proteins Recombinant Proteins Cell Biology Cytoskeleton Intermediate filaments
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
NCBI	FGF-7/HBGF-7
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fibroblast growth factor 7, FGF-7, Heparin-binding growth factor 7, HBGF-7, Keratinocyte growth factor, FGF7, KGF
Similar products	FGF7, KGF, HBGF-7, FGF-7, Fibroblast growth factor 7, Keratinocyte growth factor, Heparin-binding growth factor 7
Lieferbar
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Route	No tag
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Cys32-Thr194
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Growth Factor
Gene Symbol	FGF-7/HBGF-7
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, pH8.0, l50mM NaCl.Contact us for customized product form or formulation.
Protein Description	Recombinant Human FGF-7/HBGF-7 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys32-Thr194) of human FGF-7/KGF (Accession #P21781).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1000 ug

Listenpreis: 2.755,00 €

Preis: 2.755,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen