Comparison

Recombinant Rat PD-L1/B7-H1/CD274 Protein

€80.00
Excl. VAT
Item no. RP00800-10ug
Manufacturer Abclonal
Amount 10 ug
Category
Type Proteins Recombinant
Specific against Rat (Rattus norvegicus)
Host Rat
Purity > 95% by SDS-PAGE.
Sequence AFTITAPKDLYVVEYGSNVTMECRFPVEQKLDLLALVVYWEKEDKEVIQFVEGEEDLKPQHSSFRGRAFLPKDQLLKGNAVLQITDVKLQDAGVYCCMISYGGADYKRITLKVNAPYRKINQRISMDPATSEHELMCQAEGYPEAEVIWTNSDHQSLSGETTVTTSQTEEKLLNVTSVLRVNATANDVFHCTFWRVHSGENHTAELIIPELPVPRLPHNRT
NCBI B7-H1/PD-L1/CD274
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias B7-H, B7H1, B7-H1, B7H1PDCD1L1, CD274 antigenMGC142294, CD274 molecule, CD274, PDCD1L1, PDCD1LG1, PDL1, PD-L1, PD-L1B7 homolog 1, PDL1PDCD1 ligand 1, programmed celldeath 1 ligand 1, Programmed death ligand 1
Similar products CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1, CD274 molecule, PD-L1, B7-H, B7-H1, Programmed death ligand 1, PD-L1B7 homolog 1, PDL1PDCD1 ligand 1, B7H1PDCD1L1, CD274 antigenMGC142294, programmed celldeath 1 ligand 1
Available
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
PD-L1, also known as B7-H1 and CD274, is an approximately 65 kDa transmembrane glycoprotein in the B7family of immune regulatory molecules. PD-L1 is expressed on inflammatory-activated immune cells includingmacrophages, T cells, and B cells, keratinocytes, enothelial and intestinal epithelial cells, as well as a variety ofcarcinomas and melanoma. PD-L1 binds to T cell B7-1/CD80 and PD-1. It suppresses T cell activation andproliferation and induces the apoptosis of activated T cells. It plays a role in the development of immunetolerance by promoting T cell anergy and enhancing regulatory T cell development. PD-L1 favors thedevelopment of anti-inflammatory IL-10 and IL-22 producing dendritic cells and inhibits the development ofTh17 cells. In cancer, PD-L1 provides resistance to T cell mediated lysis, enhances EMT, and enhances thetumorigenic function of Th22 cells.
Route
C-His
Manufacturers Category
Proteins
Endotoxin
< 1 EU/μg of the protein by LAL method.
Immunogen
Ala18-Thr238
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Immune Checkpoint
Gene Symbol
B7-H1/PD-L1/CD274
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Rat PD-L1/B7-H1/CD274 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Ala18-Thr238) of rat PD-L1/B7-H1/CD274 (Accession #D4AE25) fused with a 6×His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
Listprice: €80.00
Price: €80.00
available

Delivery expected until 9/2/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close