Vergleich

Recombinant Rat PD-L1/B7-H1/CD274 Protein

80,00 €
Zzgl. MwSt.
ArtNr RP00800-10ug
Hersteller Abclonal
Menge 10 ug
Kategorie
Typ Proteins Recombinant
Specific against Rat (Rattus norvegicus)
Host Rat
Purity > 95% by SDS-PAGE.
Sequence AFTITAPKDLYVVEYGSNVTMECRFPVEQKLDLLALVVYWEKEDKEVIQFVEGEEDLKPQHSSFRGRAFLPKDQLLKGNAVLQITDVKLQDAGVYCCMISYGGADYKRITLKVNAPYRKINQRISMDPATSEHELMCQAEGYPEAEVIWTNSDHQSLSGETTVTTSQTEEKLLNVTSVLRVNATANDVFHCTFWRVHSGENHTAELIIPELPVPRLPHNRT
NCBI B7-H1/PD-L1/CD274
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias B7-H, B7H1, B7-H1, B7H1PDCD1L1, CD274 antigenMGC142294, CD274 molecule, CD274, PDCD1L1, PDCD1LG1, PDL1, PD-L1, PD-L1B7 homolog 1, PDL1PDCD1 ligand 1, programmed celldeath 1 ligand 1, Programmed death ligand 1
Similar products CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1, CD274 molecule, PD-L1, B7-H, B7-H1, Programmed death ligand 1, PD-L1B7 homolog 1, PDL1PDCD1 ligand 1, B7H1PDCD1L1, CD274 antigenMGC142294, programmed celldeath 1 ligand 1
Lieferbar
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
PD-L1, also known as B7-H1 and CD274, is an approximately 65 kDa transmembrane glycoprotein in the B7family of immune regulatory molecules. PD-L1 is expressed on inflammatory-activated immune cells includingmacrophages, T cells, and B cells, keratinocytes, enothelial and intestinal epithelial cells, as well as a variety ofcarcinomas and melanoma. PD-L1 binds to T cell B7-1/CD80 and PD-1. It suppresses T cell activation andproliferation and induces the apoptosis of activated T cells. It plays a role in the development of immunetolerance by promoting T cell anergy and enhancing regulatory T cell development. PD-L1 favors thedevelopment of anti-inflammatory IL-10 and IL-22 producing dendritic cells and inhibits the development ofTh17 cells. In cancer, PD-L1 provides resistance to T cell mediated lysis, enhances EMT, and enhances thetumorigenic function of Th22 cells.
Route
C-His
Manufacturers Category
Proteins
Endotoxin
< 1 EU/μg of the protein by LAL method.
Immunogen
Ala18-Thr238
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Immune Checkpoint
Gene Symbol
B7-H1/PD-L1/CD274
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Rat PD-L1/B7-H1/CD274 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Ala18-Thr238) of rat PD-L1/B7-H1/CD274 (Accession #D4AE25) fused with a 6×His tag at the C-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
Listenpreis: 80,00 €
Preis: 80,00 €
lieferbar

Lieferung vsl. bis 02.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen