« Back
Home /
Recombinant Cynomolgus TIM-3/HAVCR2 Protein

Recombinant Cynomolgus TIM-3/HAVCR2 Protein

€195.00

Excl. VAT

Item no.	RP00776-50ug
Manufacturer	Abclonal
Amount	50 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Monkey (Cynomolgus, Simian)
Purity	> 95% by SDS-PAGE.
Sequence	SEVEYIAEVGQNAYLPCSYTPAPPGNLVPVCWGKGACPVFDCSNVVLRTDNRDVNDRTSGRYWLKGDFHKGDVSLTIENVTLADSGVYCCRIQIPGIMNDEKHNVKLVVIKPAKVTPAPTLQRDLTSAFPRMLTTGEHGPAETQTPGSLPDVNLTVSNFFCELQIFTLTNELRDSGATIR
NCBI	Cynomolgus TIM-3/HAVCR2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	T cell immunoglobulin and mucin domain3; HAVCR2; Tim-3; TIM3
Available
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	T cell immunoglobulin and mucin domain 3 is a member of the TIM family of immune regulating molecules.Mature cynomolgus TIM3 consists of a 182 amino acid (aa)extracellular domain (ECD), a 21 aa transmembranesegment, and a 78 aa cytoplasmic tail. TIM3 is up-regulated on several populations of activated myeloid cells(macrophage, monocyte, dendritic cell, microglia, mast cell) and T cells (Th1, CD8+, NK, Treg). Its binding toGalectin9 induces a range of immunosuppressive functions which enhance immune tolerance and inhibit anti-tumor immunity. TIM3 ligation attenuates CD8+ and Th1 cell responses and promotes the activity of Treg andmyeloid derived suppressor cells. TIM3 interactions with Galectin-9 can trigger immune stimulatory effects, such as the coactivation of NK cell cytotoxicity.
Route	C-Fc
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Ser22-Arg201
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Immune Checkpoint
Gene Symbol	Cynomolgus TIM-3/HAVCR2
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Cynomolgus TIM-3/HAVCR2 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Ser22-Arg201) of cynomolgus TIM-3/HAVCR2 (Accession #G7P6Q7) fused with an Fc tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

Listprice: €195.00

Price: €195.00

available

Delivery expected until 9/30/2025

Quantity:

Compare