Comparison

Recombinant Cynomolgus TIM-3/HAVCR2 Protein

€70.00
Excl. VAT
Item no. RP00776-10ug
Manufacturer Abclonal
Amount 10 ug
Category
Type Proteins Recombinant
Specific against Monkey (Cynomolgus, Simian)
Purity > 95% by SDS-PAGE.
Sequence SEVEYIAEVGQNAYLPCSYTPAPPGNLVPVCWGKGACPVFDCSNVVLRTDNRDVNDRTSGRYWLKGDFHKGDVSLTIENVTLADSGVYCCRIQIPGIMNDEKHNVKLVVIKPAKVTPAPTLQRDLTSAFPRMLTTGEHGPAETQTPGSLPDVNLTVSNFFCELQIFTLTNELRDSGATIR
NCBI Cynomolgus TIM-3/HAVCR2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias T cell immunoglobulin and mucin domain3; HAVCR2; Tim-3; TIM3
Available
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
T cell immunoglobulin and mucin domain 3 is a member of the TIM family of immune regulating molecules.Mature cynomolgus TIM3 consists of a 182 amino acid (aa)extracellular domain (ECD), a 21 aa transmembranesegment, and a 78 aa cytoplasmic tail. TIM3 is up-regulated on several populations of activated myeloid cells(macrophage, monocyte, dendritic cell, microglia, mast cell) and T cells (Th1, CD8+, NK, Treg). Its binding toGalectin9 induces a range of immunosuppressive functions which enhance immune tolerance and inhibit anti-tumor immunity. TIM3 ligation attenuates CD8+ and Th1 cell responses and promotes the activity of Treg andmyeloid derived suppressor cells. TIM3 interactions with Galectin-9 can trigger immune stimulatory effects, such as the coactivation of NK cell cytotoxicity.
Route
C-Fc
Manufacturers Category
Proteins
Endotoxin
< 1 EU/μg of the protein by LAL method.
Immunogen
Ser22-Arg201
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Immune Checkpoint
Gene Symbol
Cynomolgus TIM-3/HAVCR2
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Cynomolgus TIM-3/HAVCR2 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Ser22-Arg201) of cynomolgus TIM-3/HAVCR2 (Accession #G7P6Q7) fused with an Fc tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
Listprice: €70.00
Price: €70.00
available

Delivery expected until 9/30/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close