Vergleich

Recombinant Cynomolgus TIM-3/HAVCR2 Protein

70,00 €
Zzgl. MwSt.
ArtNr RP00776-10ug
Hersteller Abclonal
Menge 10 ug
Kategorie
Typ Proteins Recombinant
Specific against Monkey (Cynomolgus, Simian)
Purity > 95% by SDS-PAGE.
Sequence SEVEYIAEVGQNAYLPCSYTPAPPGNLVPVCWGKGACPVFDCSNVVLRTDNRDVNDRTSGRYWLKGDFHKGDVSLTIENVTLADSGVYCCRIQIPGIMNDEKHNVKLVVIKPAKVTPAPTLQRDLTSAFPRMLTTGEHGPAETQTPGSLPDVNLTVSNFFCELQIFTLTNELRDSGATIR
NCBI Cynomolgus TIM-3/HAVCR2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias T cell immunoglobulin and mucin domain3; HAVCR2; Tim-3; TIM3
Lieferbar
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
T cell immunoglobulin and mucin domain 3 is a member of the TIM family of immune regulating molecules.Mature cynomolgus TIM3 consists of a 182 amino acid (aa)extracellular domain (ECD), a 21 aa transmembranesegment, and a 78 aa cytoplasmic tail. TIM3 is up-regulated on several populations of activated myeloid cells(macrophage, monocyte, dendritic cell, microglia, mast cell) and T cells (Th1, CD8+, NK, Treg). Its binding toGalectin9 induces a range of immunosuppressive functions which enhance immune tolerance and inhibit anti-tumor immunity. TIM3 ligation attenuates CD8+ and Th1 cell responses and promotes the activity of Treg andmyeloid derived suppressor cells. TIM3 interactions with Galectin-9 can trigger immune stimulatory effects, such as the coactivation of NK cell cytotoxicity.
Route
C-Fc
Manufacturers Category
Proteins
Endotoxin
< 1 EU/μg of the protein by LAL method.
Immunogen
Ser22-Arg201
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Immune Checkpoint
Gene Symbol
Cynomolgus TIM-3/HAVCR2
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Cynomolgus TIM-3/HAVCR2 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Ser22-Arg201) of cynomolgus TIM-3/HAVCR2 (Accession #G7P6Q7) fused with an Fc tag at the C-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
Listenpreis: 70,00 €
Preis: 70,00 €
lieferbar

Lieferung vsl. bis 30.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen