« Back
Home /
Recombinant Mouse VISTA/B7-H5/Gi24 Protein

Recombinant Mouse VISTA/B7-H5/Gi24 Protein

€70.00

Excl. VAT

Item no.	RP00750-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Purity	> 95% by SDS-PAGE.
Sequence	FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAA
NCBI	VISTA/B7-H5/Gi24
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	B7-H5,Gi24,VISTA,SISP1,VISTA
Available
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	Mouse Platelet receptor Gi24(VISTA) is a transmembrane glycoprotein with homology to B7like immunecostimulatory molecules. Mature mouse Gi24 contains a 159 amino acid (aa) extracellular domain (ECD) withone V-type Ig-like domain, a 21 aa transmembrane segment, and a 97 aa cytoplasmic domain. VISTA promotesboth MT1-MMP expression and the MT1-MMP mediated activation of MMP-2. It supports the differentiationof embryonic stem cells (ESC) and enhances BMP-4 induced signaling in ESC, but it is also down-regulatedfollowing BMP-4 exposure. It binds to BMP-4 directly and also associates with the type I BMP receptor ActivinRIB/ALK-4. It is expressed on the surface of naïve CD4+ T cells and regulatory T cells. It is up-regulated in vivoon activated monocytes and dendritic cells. VISTA inhibits CD4+ and CD8+ T cell proliferation and theirproduction of IL-2 and IFN- γ . Its expression on tumor cells attenuates the antitumor immune response andenables more rapid tumor progression.
Route	C-6×His
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Phe33-Ala191
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Immune Checkpoint
Gene Symbol	VISTA/B7-H5/Gi24
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Mouse VISTA/B7-H5/Gi24 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Phe33-Ala191) of mouse VISTA/B7-H5/Gi24 (Accession #Q9D659) fused with a 6×His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

Listprice: €70.00

Price: €70.00

available

Delivery expected until 9/30/2025

Quantity:

Compare