« Back
Home /
Recombinant Human TNFRSF8/CD30 Protein

Recombinant Human TNFRSF8/CD30 Protein

€120.00

Excl. VAT

Item no.	RP00716-50ug
Manufacturer	Abclonal
Amount	50 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 95% by SDS-PAGE.
Sequence	FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPC
NCBI	TNFRSF8/CD3
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD30, D1S166E, Ki-1,TNFRSF8, CD30, TNF receptor superfamily member 8,D1S166E,Ki-1
Available
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	CD30, also known as TNFRSF8, is a cell membrane protein of the tumor necrosis factor receptor family, whichregulates proliferation/apoptosis and antibody responses. CD30 is expressed by activated, but not by resting, Tand B cells. Aberrant expression of CD30 by mastocytosis mast cells and interaction with its ligand CD30L(CD153) appears to play an important role in the pathogenesis and clinical presentation of systemicmastocytosis. CD30 has been considered as a specific diagnostic biomarker of anaplastic large cell lymphoma(ALCL) and classical Hodgkin lymphoma (cHL). CD30 is also a biomarker used for targeted therapy by anantibody–drug conjugate.
Route	C-Fc
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Phe19-Lys379
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Cytokines & Cytokine Receptors
Gene Symbol	TNFRSF8/CD30
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mMNaCl, pH7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human TNFRSF8/CD30 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Phe19-Lys379) of human TNFRSF8/CD30 (Accession #P28908) fused with an Fc tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

Listprice: €120.00

Price: €120.00

available

Delivery expected until 9/30/2025

Quantity:

Compare