« Zurück
Startseite /
Recombinant Human TNFRSF8/CD30 Protein

Recombinant Human TNFRSF8/CD30 Protein

120,00 €

Zzgl. MwSt.

ArtNr	RP00716-50ug
Hersteller	Abclonal
Menge	50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 95% by SDS-PAGE.
Sequence	FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPC
NCBI	TNFRSF8/CD3
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD30, D1S166E, Ki-1,TNFRSF8, CD30, TNF receptor superfamily member 8,D1S166E,Ki-1
Lieferbar
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	CD30, also known as TNFRSF8, is a cell membrane protein of the tumor necrosis factor receptor family, whichregulates proliferation/apoptosis and antibody responses. CD30 is expressed by activated, but not by resting, Tand B cells. Aberrant expression of CD30 by mastocytosis mast cells and interaction with its ligand CD30L(CD153) appears to play an important role in the pathogenesis and clinical presentation of systemicmastocytosis. CD30 has been considered as a specific diagnostic biomarker of anaplastic large cell lymphoma(ALCL) and classical Hodgkin lymphoma (cHL). CD30 is also a biomarker used for targeted therapy by anantibody–drug conjugate.
Route	C-Fc
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Phe19-Lys379
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Cytokines & Cytokine Receptors
Gene Symbol	TNFRSF8/CD30
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mMNaCl, pH7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human TNFRSF8/CD30 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Phe19-Lys379) of human TNFRSF8/CD30 (Accession #P28908) fused with an Fc tag at the C-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

Listenpreis: 120,00 €

Preis: 120,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen