Comparison

Recombinant Marmoset TIM-3/HAVCR2 Protein

€59.00
Excl. VAT
Item no. RP00712-10ug
Manufacturer Abclonal
Amount 10 ug
Category
Type Proteins Recombinant
Specific against Marmoset
Purity > 95% by SDS-PAGE.
Sequence EEYIVEVGQNAYLPCFYTLDTPGNLVPVCWGKGACPVFECGDVVLRTDERDVSYRTSSRYWLNGDFHKGNVTLAIGNVTLEDSGIYCCRVQIPGIMNDKKFNLKLVIKPAKVTPAPTLPRDSTPAFPRMLTTEDHGPAETQTLEILHDKNLTQLSTLANELQDAGTTIRI
NCBI Marmoset TIM-3/HAVCR2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Hepatitis A virus cellular receptor 2 homolog;HAVcr-2;T-cell immunoglobulin and mucin domain-containing protein 3;T-cell immunoglobulin mucin receptor 3;T-cell membrane protein 3;Tim3;Timd3
Available
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
T cell immunoglobulin and mucin domain-3 (TIM3, HAVCR2), is a transmembrane glycoprotein of the TIMfamily of immune regulating molecules and plays an important role in the Th1-mediated immune response.TIM3 is expressed on the Th1 cells, CD8 T-cells, monocytes, and dendritic cells, but not on Th2 cells. TIM3expressed by monocytes and dendritic cells facilitates phagocytosis of apoptotic cells and up-regulates cross-presentation of apoptotic cell-associated antigens through interaction with phosphatidylserine. Engagement ofTIM3 by its ligand galectin-9 induces a range of immunosuppressive functions which enhance immunetolerance and inhibit anti-tumor immunity. Stimulation of TIM3 with an agonistic antibody promotesinflammation through the activation of innate immune cells. TIM3 is also regarded as a potential targetmolecule for immunotherapy. TIM3 and programmed cell death 1 (PD-1) as two important coinhibitoryregulators of T cell responses, have been implicated with the T-cell dysfunction or exhaustion associated withchronic HBV infection including HBV-related HCC.
Route
C-6×His
Manufacturers Category
Proteins
Endotoxin
< 1 EU/μg of the protein by LAL method.
Immunogen
Glu24-Ile193
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Immune Checkpoint
Gene Symbol
Marmoset TIM-3/HAVCR2
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Marmoset TIM-3/HAVCR2 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Glu24-Ile193) of marmoset TIM-3/HAVCR2 (Accession #F7I881) fused with a 6×His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
Listprice: €59.00
Price: €59.00
available

Delivery expected until 9/30/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close