Vergleich

Recombinant Marmoset TIM-3/HAVCR2 Protein

59,00 €
Zzgl. MwSt.
ArtNr RP00712-10ug
Hersteller Abclonal
Menge 10 ug
Kategorie
Typ Proteins Recombinant
Specific against Marmoset
Purity > 95% by SDS-PAGE.
Sequence EEYIVEVGQNAYLPCFYTLDTPGNLVPVCWGKGACPVFECGDVVLRTDERDVSYRTSSRYWLNGDFHKGNVTLAIGNVTLEDSGIYCCRVQIPGIMNDKKFNLKLVIKPAKVTPAPTLPRDSTPAFPRMLTTEDHGPAETQTLEILHDKNLTQLSTLANELQDAGTTIRI
NCBI Marmoset TIM-3/HAVCR2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Hepatitis A virus cellular receptor 2 homolog;HAVcr-2;T-cell immunoglobulin and mucin domain-containing protein 3;T-cell immunoglobulin mucin receptor 3;T-cell membrane protein 3;Tim3;Timd3
Lieferbar
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
T cell immunoglobulin and mucin domain-3 (TIM3, HAVCR2), is a transmembrane glycoprotein of the TIMfamily of immune regulating molecules and plays an important role in the Th1-mediated immune response.TIM3 is expressed on the Th1 cells, CD8 T-cells, monocytes, and dendritic cells, but not on Th2 cells. TIM3expressed by monocytes and dendritic cells facilitates phagocytosis of apoptotic cells and up-regulates cross-presentation of apoptotic cell-associated antigens through interaction with phosphatidylserine. Engagement ofTIM3 by its ligand galectin-9 induces a range of immunosuppressive functions which enhance immunetolerance and inhibit anti-tumor immunity. Stimulation of TIM3 with an agonistic antibody promotesinflammation through the activation of innate immune cells. TIM3 is also regarded as a potential targetmolecule for immunotherapy. TIM3 and programmed cell death 1 (PD-1) as two important coinhibitoryregulators of T cell responses, have been implicated with the T-cell dysfunction or exhaustion associated withchronic HBV infection including HBV-related HCC.
Route
C-6×His
Manufacturers Category
Proteins
Endotoxin
< 1 EU/μg of the protein by LAL method.
Immunogen
Glu24-Ile193
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Immune Checkpoint
Gene Symbol
Marmoset TIM-3/HAVCR2
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Marmoset TIM-3/HAVCR2 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Glu24-Ile193) of marmoset TIM-3/HAVCR2 (Accession #F7I881) fused with a 6×His tag at the C-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
Listenpreis: 59,00 €
Preis: 59,00 €
lieferbar

Lieferung vsl. bis 30.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen