Comparison

Recombinant Mouse PD-L2/B7-DC/CD273 Protein

€140.00
Excl. VAT
Item no. RP00660-50ug
Manufacturer Abclonal
Amount 50 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Host Mouse
Purity > 95% by SDS-PAGE.
Sequence LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR
NCBI B7-DC/PD-L2/CD273
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Programmed cell death 1 ligand 2, Pdcd1lg2, PD-1 ligand 2, PD-L2, PDCD1 ligand 2, B7-DC, CD273,
Similar products CD273, Programmed cell death 1 ligand 2, Pdcd1lg2, PD-L2, B7-DC, PD-1 ligand 2, PDCD1 ligand 2
Available
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
Programmed cell death 1 ligand 2 (PD-L2)belongs to the member of B7 family which can regulate theactivation and tolerance of T cells. PD-L2 is one ligand for Programmed cell death 1(PD-1), and the other is PD-L1. These two ligands shares 34% aa sequence identity.The mouse PD-L2 gene is highly expressed in heart, placenta, pancreas, lung and liver while expressed weakly in spleen, lymph nodes and thymus. Besides, theexpression of PD-L2 gene can be induced on dendritic cells grown from peripheral blood mononuclear cellsunder CSF2 and IL4/interleukin-4 treatment, and up-regulated by IFNG/IFN-gamma stimulation in monocytes.PD-L2 usually functions in a PDCD1-independent manner and is involved in regulating costimulatory signalwhich is essential for T-cell proliferation and IFNG production. Recent studies demonstrate that the expressionof PD-L2 on the tumor cells promotes CD8 T cell–mediated rejection of tumor cells, at both the induction andeffector phase of antitumor immunity. Moreover, PD-L2 binds to PD-1 cells and enhances T cell killing in a PD-1–independent mechanism.
Route
C-Fc
Manufacturers Category
Proteins
Endotoxin
< 1 EU/μg of the protein by LAL method.
Immunogen
Leu20-Arg219
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Immune Checkpoint
Gene Symbol
B7-DC/PD-L2/CD273
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Mouse PD-L2/B7-DC/CD273 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Leu20-Arg219) of mouse PD-L2/B7-DC/CD273 (Accession #Q9WUL5) fused with an Fc tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
Listprice: €140.00
Price: €140.00
available

Delivery expected until 9/2/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close