Vergleich

Recombinant Mouse PD-L2/B7-DC/CD273 Protein

140,00 €
Zzgl. MwSt.
ArtNr RP00660-50ug
Hersteller Abclonal
Menge 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Host Mouse
Purity > 95% by SDS-PAGE.
Sequence LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR
NCBI B7-DC/PD-L2/CD273
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Programmed cell death 1 ligand 2, Pdcd1lg2, PD-1 ligand 2, PD-L2, PDCD1 ligand 2, B7-DC, CD273,
Similar products CD273, Programmed cell death 1 ligand 2, Pdcd1lg2, PD-L2, B7-DC, PD-1 ligand 2, PDCD1 ligand 2
Lieferbar
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
Programmed cell death 1 ligand 2 (PD-L2)belongs to the member of B7 family which can regulate theactivation and tolerance of T cells. PD-L2 is one ligand for Programmed cell death 1(PD-1), and the other is PD-L1. These two ligands shares 34% aa sequence identity.The mouse PD-L2 gene is highly expressed in heart, placenta, pancreas, lung and liver while expressed weakly in spleen, lymph nodes and thymus. Besides, theexpression of PD-L2 gene can be induced on dendritic cells grown from peripheral blood mononuclear cellsunder CSF2 and IL4/interleukin-4 treatment, and up-regulated by IFNG/IFN-gamma stimulation in monocytes.PD-L2 usually functions in a PDCD1-independent manner and is involved in regulating costimulatory signalwhich is essential for T-cell proliferation and IFNG production. Recent studies demonstrate that the expressionof PD-L2 on the tumor cells promotes CD8 T cell–mediated rejection of tumor cells, at both the induction andeffector phase of antitumor immunity. Moreover, PD-L2 binds to PD-1 cells and enhances T cell killing in a PD-1–independent mechanism.
Route
C-Fc
Manufacturers Category
Proteins
Endotoxin
< 1 EU/μg of the protein by LAL method.
Immunogen
Leu20-Arg219
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Immune Checkpoint
Gene Symbol
B7-DC/PD-L2/CD273
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Mouse PD-L2/B7-DC/CD273 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Leu20-Arg219) of mouse PD-L2/B7-DC/CD273 (Accession #Q9WUL5) fused with an Fc tag at the C-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
Listenpreis: 140,00 €
Preis: 140,00 €
lieferbar

Lieferung vsl. bis 02.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen