Comparison

Recombinant Human c-kit/CD117/Mast/stem Cell Growth Factor Receptor Kit Protein

€59.00
Excl. VAT
Item no. RP00585-10ug
Manufacturer Abclonal
Amount 10 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 95% by SDS-PAGE.
Sequence QPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSA
NCBI c-kit/CD117/Mast/stem Cell Growth Factor Receptor Kit
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias KIT,C-Kit,CD117,PBT,SCFR,c-kit
Available
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
C-Kit/SCF R is a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cellfactor). c-Kit contains 5 Ig-like C2-type (immunoglobulin-like) domains and 1 protein kinase domain. It belongsto the protein kinase superfamily and CSF-1/PDGF receptor subfamily. SCF R expression on mast cells enablesthem to infiltrate SCF-secreting tumors where they promote tumor growth and induce local immunesuppression. SCF R is up-regulated on dendritic cells by Th2-orTh17-biasing stimuli, and it is required forsubsequent dendritic cell induction of Th2 and Th17 responses. SCF R protects vascular smooth muscle cellsfrom apoptosis and assists in the recovery of cardiac function following myocardial infarction.
Route
C-6×His
Manufacturers Category
Proteins
Endotoxin
< 1 EU/μg of the protein by LAL method.
Immunogen
Gln26-Thr520
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Bio-Markers & CD Antigens
Gene Symbol
c-kit/CD117/Mast/stem Cell Growth Factor Receptor Kit
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Human c-kit/CD117/Mast/stem Cell Growth Factor Receptor Kit Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gln26-Thr520) of human c-kit/CD117/Mast/stem Cell Growth Factor Receptor Kit (Accession #P10721) fused with a 6×His tag at the C-terminus.
Protein Bio Activity
Measured by its ability to inhibit SCF-dependent proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is 2-6 μg/mL in the presence of 8 ng/mL of recombinant human CD117.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
Listprice: €59.00
Price: €59.00
available

Delivery expected until 9/30/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close