Vergleich

Recombinant Human c-kit/CD117/Mast/stem Cell Growth Factor Receptor Kit Protein

59,00 €
Zzgl. MwSt.
ArtNr RP00585-10ug
Hersteller Abclonal
Menge 10 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 95% by SDS-PAGE.
Sequence QPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSA
NCBI c-kit/CD117/Mast/stem Cell Growth Factor Receptor Kit
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias KIT,C-Kit,CD117,PBT,SCFR,c-kit
Lieferbar
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
C-Kit/SCF R is a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cellfactor). c-Kit contains 5 Ig-like C2-type (immunoglobulin-like) domains and 1 protein kinase domain. It belongsto the protein kinase superfamily and CSF-1/PDGF receptor subfamily. SCF R expression on mast cells enablesthem to infiltrate SCF-secreting tumors where they promote tumor growth and induce local immunesuppression. SCF R is up-regulated on dendritic cells by Th2-orTh17-biasing stimuli, and it is required forsubsequent dendritic cell induction of Th2 and Th17 responses. SCF R protects vascular smooth muscle cellsfrom apoptosis and assists in the recovery of cardiac function following myocardial infarction.
Route
C-6×His
Manufacturers Category
Proteins
Endotoxin
< 1 EU/μg of the protein by LAL method.
Immunogen
Gln26-Thr520
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Bio-Markers & CD Antigens
Gene Symbol
c-kit/CD117/Mast/stem Cell Growth Factor Receptor Kit
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Human c-kit/CD117/Mast/stem Cell Growth Factor Receptor Kit Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gln26-Thr520) of human c-kit/CD117/Mast/stem Cell Growth Factor Receptor Kit (Accession #P10721) fused with a 6×His tag at the C-terminus.
Protein Bio Activity
Measured by its ability to inhibit SCF-dependent proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is 2-6 μg/mL in the presence of 8 ng/mL of recombinant human CD117.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
Listenpreis: 59,00 €
Preis: 59,00 €
lieferbar

Lieferung vsl. bis 30.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen