« Back
Home /
Recombinant Human IL-20RA/IL-20 R alpha Protein

Recombinant Human IL-20RA/IL-20 R alpha Protein

€290.00

Excl. VAT

Item no.	RP00537-50ug
Manufacturer	Abclonal
Amount	50 ug
Category	Peptides & Proteins Recombinant Proteins Cardiovascular Research Atherosclerosis
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK
NCBI	IL-2RA
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Interleukin-20 Receptor Subunit Alpha, IL-20 Receptor Subunit Alpha, IL-20R-Alpha, IL-20RA, Cytokine Receptor Class-II Member 8, Cytokine Receptor Family 2 Member 8, CRF2-8, IL-20R1, ZcytoR7, IL20RA
Similar products	IL-20R1, IL20RA, CRF2-8, ZcytoR7, IL-20RA, Interleukin-20 Receptor Subunit Alpha, IL-20 Receptor Subunit Alpha, IL-20R-Alpha, Cytokine Receptor Class-II Member 8, Cytokine Receptor Family 2 Member 8
Available
Description	Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	Interleukin-20 Receptor Subunit α (IL20RA) is a single-pass type I membrane protein that is a member of thetype II cytokine receptor family. IL20RA is synthetized a 553 amino acid glycoprotein precursor containing a 29amino acid signal peptide, a 221 amino acid extracellular domain with two fibronectin type-III domains, a 24amino acid transmembrane region, and a 279 amino acid intracellular domain. IL20RA is widely expressed withhighest levels found in skin and testis and high levels in brain. IL20RA forms a heterodimer with IL20RB, andthe complex serves as a receptor for IL19, IL20 and IL24. IL20RA also forms a heterodimer with the unique andspecific receptor IL10RB and functions as the receptor for IL26.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Val30-Lys250
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Interleukin
Gene Symbol	IL-20RA
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human IL-20RA/IL-20 R alpha Protein is produced by Human cells expression system. The target protein is expressed with sequence (Val30-Lys250) of human IL-20RA/IL-20 R alpha (Accession #Q9UHF4) fused with a 6×His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

Listprice: €290.00

Price: €290.00

available

Delivery expected until 9/30/2025

Quantity:

Compare