« Back
Home /
Recombinant Mouse Alpha-enolase(Eno1),partial

Recombinant Mouse Alpha-enolase(Eno1),partial

€271.00

Excl. VAT

Item no.	CSB-EP007670MO-20
Manufacturer	Cusabio
Amount	20ug
Category	Food Safety Proteins Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Others
Uniprot ID	P17182
Gene Names	Eno1
Organism	Mus musculus (Mouse)
AA Sequence	SILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVP SGASTGIYEALELRDNDKTRFMGKGVSQAVEHINK TIAPALVSKKVNVVEQEKIDKLMIEMDGTENKSKF GANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNP EVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAS SFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEG GFAPNILENKEALELLKTAIAKAGYTDQVVIGMDV AASEFYRSGKYDLDFKSPDDPSRYITPDQLADLYK SFVQNYPVVSIEDPFDQDDWGAWQKFTASAGIQVV GDDLTVTNPKRIAKAASEKSCNCLLLKVNQIGSVT ESLQACKLAQSNGWGVMVSHRSGETEDTFIADLVV GLCTGQIKTGAPCRSERLAKYNQILRIEEELGSKA KFAGRSFRNPLA
Expression Region	2-433aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	50.9 kDa
Alternative Name(s)	2-phospho-D-glycerate hydro-lyase; Enolase 1Non-neural enolase ; NNE
Relevance	Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses . May also function in the intravascular and pericellular fibrinolytic syst due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production .
Reference	SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses (By similarity). May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production (By similarity).
Subcellular Location	Cytoplasm, Cell membrane
Protein Families	Enolase family
Tissue Specificity	Testis. Found in the principal piece of sperm tail (at protein level). The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons. In striated muscle, expression of ENO1 appears to be independent of fiber type.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

Listprice: €271.00

Price: €271.00

available

Quantity:

Compare

Add to wishlist