« Back
Home /
β-Endorphin, human

β-Endorphin, human

€71.00

Excl. VAT

Item no.	RP11344
Manufacturer	GenScript
Amount	1 mg
Category	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Peptides
Type	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE ; {TYR}{GLY}{GLY}{PHE}{MET}{THR}{SER}{GLU}{LYS}{SER}{GLN}{THR}{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}{ALA}{ILE}{ILE}{LYS}{ASN}{ALA}{TYR}{LYS}{LYS}{GLY}{GLU}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP11344-b-Endorphin_human, Potent endogenous opioid protein b-Endorphin is derived from propiomelanocortin, b-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. beta-Endorphin is released in response to painful stimuli and b-Endorphin has potent antinociceptive activity mediated through its action on u receptors in brain and by u and kappa receptors in the spinal cord. </td></tr><tr><th>Solubility</th><td colspan="7"> The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C </td></tr>
Similar products	beta-Endorphin
Available
Description	Potent endogenous opioid protein b-Endorphin is derived from propiomelanocortin, b-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. beta-Endorphin is released in response to painful stimuli and b-Endorphin has potent antinociceptive activity mediated through its action on u receptors in brain and by u and kappa receptors in the spinal cord.
Solubility	The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Storage	Store the peptide at -20C
Manufacturers Category	Peptides & Chemicals
Manufacturers Product Line	Other Peptides
Product Origin	USA

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.