« Back
Home /
Recombinant Macaca fascicularis Interleukin-11 (IL11), Biotinylated

Recombinant Macaca fascicularis Interleukin-11 (IL11), Biotinylated

€1,060.00

Excl. VAT

Item no.	BM-RPC27611-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Protein Type	Recombinant Protein
Gene Name	Il11
Alternative Names	IL-11
Uniprot	P20808
Expression Region	22-199aa
AA Sequence	PGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQLKDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLKTLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Theoretical MW	67.2 kDa
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not Tested
Shipping Condition	Ice packs
Storage	Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Expiry Date	1 year
Research Area	Cancer
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

Listprice: €1,060.00

Price: €1,060.00

available

Delivery expected until 9/25/2025

Quantity:

Compare