« Zurück
Startseite /
Recombinant Macaca fascicularis Interleukin-11 (IL11), Biotinylated

Recombinant Macaca fascicularis Interleukin-11 (IL11), Biotinylated

1.060,00 €

Zzgl. MwSt.

ArtNr	BM-RPC27611-100ug
Hersteller	Biomatik
Menge	100ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Protein Type	Recombinant Protein
Gene Name	Il11
Alternative Names	IL-11
Uniprot	P20808
Expression Region	22-199aa
AA Sequence	PGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQLKDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLKTLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Theoretical MW	67.2 kDa
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not Tested
Shipping Condition	Ice packs
Storage	Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Expiry Date	1 year
Research Area	Cancer
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

Listenpreis: 1.060,00 €

Preis: 1.060,00 €

lieferbar

Lieferung vsl. bis 25.09.2025

Anzahl:

Vergleichen