« Back
Home /
Recombinant Human Interleukin-8 (CXCL8), partial

Recombinant Human Interleukin-8 (CXCL8), partial

€543.00

Excl. VAT

Item no.	BM-RPC25857-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin,Granulocyte chemotactic protein 1,GCP-1Monocyte-derived neutrophil chemotactic factor,MDNCFMonocyte-derived neutrophil-activating peptide,MONAPNeutrophil-activating protein 1,NAP-1,Protein 3-1
Similar products	Granulocyte chemotactic protein 1, NAP-1, C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin, GCP-1Monocyte-derived neutrophil chemotactic factor, MDNCFMonocyte-derived neutrophil-activating peptide, MONAPNeutrophil-activating protein 1, Protein 3-10CT-cell chemotactic factor
Available
Gene Name	CXCL8
Alternative Names	C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin, Granulocyte chemotactic protein 1, GCP-1Monocyte-derived neutrophil chemotactic factor, MDNCFMonocyte-derived neutrophil-activating peptide, MONAPNeutrophil-activating protein 1, NAP-1, Protein 3-10CT-cell chemotactic factor
Uniprot	P10145
Source	E.coli
Expression Region	23-99aa
AA Sequence	AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIES GPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF LKRAENS
Sequence Info	Partial
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	12.9 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 10-15-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Function	IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 10-15-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Subcellular location	Secreted
Protein Families	Intercrine alpha (chemokine CxC) family
Paythway	Chemokinesignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

Listprice: €543.00

Price: €543.00

available

Delivery expected until 9/25/2025

Quantity:

Compare