« Zurück
Startseite /
Recombinant Human Interleukin-8 (CXCL8), partial

Recombinant Human Interleukin-8 (CXCL8), partial

543,00 €

Zzgl. MwSt.

ArtNr	BM-RPC25857-100ug
Hersteller	Biomatik
Menge	100ug
Kategorie	Oncology Neuroscience Neuroinflammation Metabolism Diabetes By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin,Granulocyte chemotactic protein 1,GCP-1Monocyte-derived neutrophil chemotactic factor,MDNCFMonocyte-derived neutrophil-activating peptide,MONAPNeutrophil-activating protein 1,NAP-1,Protein 3-1
Similar products	Granulocyte chemotactic protein 1, NAP-1, C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin, GCP-1Monocyte-derived neutrophil chemotactic factor, MDNCFMonocyte-derived neutrophil-activating peptide, MONAPNeutrophil-activating protein 1, Protein 3-10CT-cell chemotactic factor
Lieferbar
Gene Name	CXCL8
Alternative Names	C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin, Granulocyte chemotactic protein 1, GCP-1Monocyte-derived neutrophil chemotactic factor, MDNCFMonocyte-derived neutrophil-activating peptide, MONAPNeutrophil-activating protein 1, NAP-1, Protein 3-10CT-cell chemotactic factor
Uniprot	P10145
Source	E.coli
Expression Region	23-99aa
AA Sequence	AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIES GPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF LKRAENS
Sequence Info	Partial
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	12.9 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 10-15-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Function	IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 10-15-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Subcellular location	Secreted
Protein Families	Intercrine alpha (chemokine CxC) family
Paythway	Chemokinesignalingpathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

Listenpreis: 543,00 €

Preis: 543,00 €

lieferbar

Lieferung vsl. bis 25.09.2025

Anzahl:

Vergleichen