Comparison

MERS Coronavirus Envelope (HSZ-Cc) Recombinant Protein European Partner

Item no. 20-226-0.1mg
Manufacturer Sino Biological
Amount 0.1mg
Category
Type Proteins Recombinant
Format Liquid
Specific against other
Host Bacteria
Dry ice Yes
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias MERS-CoV HSZ-Cc-E Protein, E Protein MERS-CoV HSZ-Cc, Envelope Protein MERS-CoV HSZ-Cc, MERS-CoV HSZ-Cc Envelope Protein
Available
Research Area
Infectious Disease
Source
Other
Fusion Tag
N-Term GST Uncleaved
Sequence
Native Sequence:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCMTGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV

Amino acids M1 – V82 (end).
Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.

Protease Cleavage:
PreScission (LEVLFQGP) residues 221 - 228
Buffer
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.03 % Brij-35
Storage Conditions
Store at -70 °C. Avoid repeated freeze-thaw cycles.
Accession #
AGV08472.1
Predicted Molecular Weight
Mono-Isotopic Mass: 36, 154.49 daltons
Average Mass: 36, 178.40 daltons
Purity
GSH-Agarose (0.65)
Disclaimer
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.1mg
Available: In stock
available

Delivery expected until 9/4/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close