Vergleich

MERS Coronavirus Envelope (HSZ-Cc) Recombinant Protein Europäischer Partner

ArtNr 20-226-0.1mg
Hersteller Sino Biological
Menge 0.1mg
Kategorie
Typ Proteins Recombinant
Format Liquid
Specific against other
Host Bacteria
Dry ice Yes
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias MERS-CoV HSZ-Cc-E Protein, E Protein MERS-CoV HSZ-Cc, Envelope Protein MERS-CoV HSZ-Cc, MERS-CoV HSZ-Cc Envelope Protein
Lieferbar
Research Area
Infectious Disease
Source
Other
Fusion Tag
N-Term GST Uncleaved
Sequence
Native Sequence:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCMTGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV

Amino acids M1 – V82 (end).
Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.

Protease Cleavage:
PreScission (LEVLFQGP) residues 221 - 228
Buffer
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.03 % Brij-35
Storage Conditions
Store at -70 °C. Avoid repeated freeze-thaw cycles.
Accession #
AGV08472.1
Predicted Molecular Weight
Mono-Isotopic Mass: 36, 154.49 daltons
Average Mass: 36, 178.40 daltons
Purity
GSH-Agarose (0.65)
Disclaimer
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.1mg
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 04.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen