Comparison

TNF-α, Mouse European Partner

€180.00
Excl. VAT
Item no. Z02774-20
Manufacturer GenScript
Amount 20 ug
Category
Type Proteins
Format Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against Mouse (Murine, Mus musculus)
Purity >97% by SDS-PAGE and HPLC analyses.
Sequence MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVY SQVLFKGQGC PDYVLLTHTV SRFAISYQEKVNLLSAVKSP CPKDTPEGAE LKPWYEPIYL GGVFQLEKGD QLSAEVNLPK YLDFAESGQV YFGVIAL
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias protein/Z02774-Tumor_Necrosis_Factor-alpha_TNF-alpha_Mouse, Tumor necrosis factor alpha (TNF-alpha) is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes endothelial cells, smooth muscle cells and some transformed cells. Mouse TNF-alpha occurs as a membrane-anchored form. The naturally-occurring form of TNF-alpha is glycosylated, but non-glycosylated recombinant TNF-alpha has comparable biological activity. The biologically active native form of TNF-alpha is reportedly a trimer. Human and mouse TNF-alpha show approximately 79% homology at the amino acid level and crossreactivity between the two species.</td></tr><tr><th>M.W.</th><td colspan="7"> Approximately 17.3 kDa. The recombinant mouse TNF-alpha is a soluble 157 amino acid protein which corresponds to C-terminal extracellular domain of the full length transmembrane protein.</td></tr><tr><th>Purity</th><td colspan="7"> >97% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rMuTNF-alpha as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. The ED50 as determined by the cytolysis of murine L929 cells in the presence of actinomycin D is, 1.0×107 units/mg.</td></tr><tr><th>Storage</th><td colspan="7"> This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.</td></tr><tr><th>Formulation</th><td colspan="7"> Lyophilized from a 0.2um filtered solution in PBS, pH 7.2.</td></tr><tr><th>Reconstitution</th><td colspan="7"> We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.</td></tr><tr><th>Physical Appearance</th><td colspan="7"> Sterile Filtered White lyophilized (freeze-dried) powder.</td></tr><tr><th>Usage</th><td colspan="7"> This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.</td></tr><tr><th>Sequence</th><td colspan="7"> MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVY SQVLFKGQGC PDYVLLTHTV SRFAISYQEKVNLLSAVKSP CPKDTPEGAE LKPWYEPIYL GGVFQLEKGD QLSAEVNLPK YLDFAESGQV YFGVIAL </td></tr>
Similar products Tumor
Available
Specificity Fully biologically active when compared to standard. The ED50 as determined by the cytolysis of murine L929 cells in the presence of actinomycin D is, 1.0x107 units/mg.
Specificity
Fully biologically active when compared to standard. The ED50 as determined by the cytolysis of murine L929 cells in the presence of actinomycin D is, 1.0x107 units/mg.
Description
Tumor necrosis factor alpha (TNF-alpha) is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes endothelial cells, smooth muscle cells and some transformed cells. Mouse TNF-alpha occurs as a membrane-anchored form. The naturally-occurring form of TNF-alpha is glycosylated, but non-glycosylated recombinant TNF-alpha has comparable biological activity. The biologically active native form of TNF-alpha is reportedly a trimer. Human and mouse TNF-alpha show approximately 79% homology at the amino acid level and crossreactivity between the two species.
Endotoxin Level
Less than 0.2EU/ug of rMuTNF-alpha as determined by LAL method.
Formulation
Lyophilized from a 0.2um filtered solution in PBS, pH 7.2.
M.W.
Approximately 17.3 kDa. The recombinant mouse TNF-alpha is a soluble 157 amino acid protein which corresponds to C-terminal extracellular domain of the full length transmembrane protein.
Product Line
Cytokine, Chemokines & Growth Factors
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.
Storage
This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Usage
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Manufacturers Category
Proteins
Manufacturers Product Line
Cytokines
Product Origin
USA

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
Listprice: €180.00
Price: €180.00
available

Delivery expected until 9/4/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close