TNF-α, Mouse

180,00 €

Zzgl. MwSt.

ArtNr	Z02774-20
Hersteller	GenScript
Menge	20 ug
Kategorie	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Glucose Homeostasis By Cell Type Peptides & Proteins Recombinant Proteins Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis Cytoskeleton By Organ Skin Cancer small GTPases Arf Subfamily
Typ	Proteins
Format	Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against	Mouse (Murine, Mus musculus)
Purity	>97% by SDS-PAGE and HPLC analyses.
Sequence	MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVY SQVLFKGQGC PDYVLLTHTV SRFAISYQEKVNLLSAVKSP CPKDTPEGAE LKPWYEPIYL GGVFQLEKGD QLSAEVNLPK YLDFAESGQV YFGVIAL
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	protein/Z02774-Tumor_Necrosis_Factor-alpha_TNF-alpha_Mouse, Tumor necrosis factor alpha (TNF-alpha) is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes endothelial cells, smooth muscle cells and some transformed cells. Mouse TNF-alpha occurs as a membrane-anchored form. The naturally-occurring form of TNF-alpha is glycosylated, but non-glycosylated recombinant TNF-alpha has comparable biological activity. The biologically active native form of TNF-alpha is reportedly a trimer. Human and mouse TNF-alpha show approximately 79% homology at the amino acid level and crossreactivity between the two species.</td></tr><tr><th>M.W.</th><td colspan="7"> Approximately 17.3 kDa. The recombinant mouse TNF-alpha is a soluble 157 amino acid protein which corresponds to C-terminal extracellular domain of the full length transmembrane protein.</td></tr><tr><th>Purity</th><td colspan="7"> >97% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rMuTNF-alpha as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. The ED50 as determined by the cytolysis of murine L929 cells in the presence of actinomycin D is, 1.0×107 units/mg.</td></tr><tr><th>Storage</th><td colspan="7"> This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.</td></tr><tr><th>Formulation</th><td colspan="7"> Lyophilized from a 0.2um filtered solution in PBS, pH 7.2.</td></tr><tr><th>Reconstitution</th><td colspan="7"> We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.</td></tr><tr><th>Physical Appearance</th><td colspan="7"> Sterile Filtered White lyophilized (freeze-dried) powder.</td></tr><tr><th>Usage</th><td colspan="7"> This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.</td></tr><tr><th>Sequence</th><td colspan="7"> MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVY SQVLFKGQGC PDYVLLTHTV SRFAISYQEKVNLLSAVKSP CPKDTPEGAE LKPWYEPIYL GGVFQLEKGD QLSAEVNLPK YLDFAESGQV YFGVIAL </td></tr>
Similar products	Tumor
Lieferbar
Specificity	Fully biologically active when compared to standard. The ED50 as determined by the cytolysis of murine L929 cells in the presence of actinomycin D is, 1.0x107 units/mg.
Specificity	Fully biologically active when compared to standard. The ED50 as determined by the cytolysis of murine L929 cells in the presence of actinomycin D is, 1.0x107 units/mg.
Description	Tumor necrosis factor alpha (TNF-alpha) is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes endothelial cells, smooth muscle cells and some transformed cells. Mouse TNF-alpha occurs as a membrane-anchored form. The naturally-occurring form of TNF-alpha is glycosylated, but non-glycosylated recombinant TNF-alpha has comparable biological activity. The biologically active native form of TNF-alpha is reportedly a trimer. Human and mouse TNF-alpha show approximately 79% homology at the amino acid level and crossreactivity between the two species.
Endotoxin Level	Less than 0.2EU/ug of rMuTNF-alpha as determined by LAL method.
Formulation	Lyophilized from a 0.2um filtered solution in PBS, pH 7.2.
M.W.	Approximately 17.3 kDa. The recombinant mouse TNF-alpha is a soluble 157 amino acid protein which corresponds to C-terminal extracellular domain of the full length transmembrane protein.
Product Line	Cytokine, Chemokines & Growth Factors
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.
Storage	This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Usage	This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Manufacturers Category	Proteins
Manufacturers Product Line	Cytokines
Product Origin	USA

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Z02774-20-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

Listenpreis: 180,00 €

Preis: 180,00 €

lieferbar

Lieferung vsl. bis 04.09.2025

Anzahl:

Vergleichen