« Back
Home /
Neuropeptide Y, human

Neuropeptide Y, human

€71.00

Excl. VAT

Item no.	RP10492-0.5
Manufacturer	GenScript
Amount	0,5 mg
Category	Oncology Neuroscience Metabolism Glucose Homeostasis Regulation of Appetite Molecular Targets for Neuroscience Peptides & Proteins Obesity Peptides By Organ Skin Cancer
Type	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 ; {TYR}{PRO}{SER}{LYS}{PRO}{ASP}{ASN}{PRO}{GLY}{GLU}{ASP}{ALA}{PRO}{ALA}{GLU}{ASP}{MET}{ALA}{ARG}{TYR}{TYR}{SER}{ALA}{LEU}{ARG}{HIS}{TYR}{ILE}{ASN}{LEU}{ILE}{THR}{ARG}{GLN}{ARG}{TYR}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10492-Neuropeptide_Y_NPY_human, Neuropeptide Y (NPY) is a vasoconstrictor and a brain peptide that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Neuropeptide Y (NPY) is implicated in the control of blood pressure, sexual behavior, and food intake. Neuropeptide Y (NPY) inhibits cholecystokinin- and secretin-stimulated pancreatic secretion. </td></tr><tr><th>Solubility</th><td colspan="7"> Solvent: 1 mg/ml CH3COOH 0.05 M clear, colorless </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr>
Similar products	Neuropeptide
Available
C-Terminal	NH2
Description	Neuropeptide Y (NPY) is a vasoconstrictor and a brain peptide that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Neuropeptide Y (NPY) is implicated in the control of blood pressure, sexual behavior, and food intake. Neuropeptide Y (NPY) inhibits cholecystokinin- and secretin-stimulated pancreatic secretion.
Solubility	Solvent: 1 mg/ml CH3COOH 0.05 M clear, colorless
Storage	Store at -20C.
Manufacturers Category	Peptides & Chemicals
Manufacturers Product Line	Other Peptides
Product Origin	USA

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0,5 mg

Listprice: €71.00

Price: €71.00

available

Delivery expected until 9/4/2025

Quantity:

Compare