« Zurück
Startseite /
Neuropeptide Y, human

Neuropeptide Y, human

71,00 €

Zzgl. MwSt.

ArtNr	RP10492-0.5
Hersteller	GenScript
Menge	0,5 mg
Kategorie	Oncology Neuroscience Metabolism Glucose Homeostasis Regulation of Appetite Molecular Targets for Neuroscience Peptides & Proteins Obesity Peptides By Organ Skin Cancer
Typ	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 ; {TYR}{PRO}{SER}{LYS}{PRO}{ASP}{ASN}{PRO}{GLY}{GLU}{ASP}{ALA}{PRO}{ALA}{GLU}{ASP}{MET}{ALA}{ARG}{TYR}{TYR}{SER}{ALA}{LEU}{ARG}{HIS}{TYR}{ILE}{ASN}{LEU}{ILE}{THR}{ARG}{GLN}{ARG}{TYR}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10492-Neuropeptide_Y_NPY_human, Neuropeptide Y (NPY) is a vasoconstrictor and a brain peptide that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Neuropeptide Y (NPY) is implicated in the control of blood pressure, sexual behavior, and food intake. Neuropeptide Y (NPY) inhibits cholecystokinin- and secretin-stimulated pancreatic secretion. </td></tr><tr><th>Solubility</th><td colspan="7"> Solvent: 1 mg/ml CH3COOH 0.05 M clear, colorless </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr>
Similar products	Neuropeptide
Lieferbar
C-Terminal	NH2
Description	Neuropeptide Y (NPY) is a vasoconstrictor and a brain peptide that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Neuropeptide Y (NPY) is implicated in the control of blood pressure, sexual behavior, and food intake. Neuropeptide Y (NPY) inhibits cholecystokinin- and secretin-stimulated pancreatic secretion.
Solubility	Solvent: 1 mg/ml CH3COOH 0.05 M clear, colorless
Storage	Store at -20C.
Manufacturers Category	Peptides & Chemicals
Manufacturers Product Line	Other Peptides
Product Origin	USA

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0,5 mg

Listenpreis: 71,00 €

Preis: 71,00 €

lieferbar

Lieferung vsl. bis 04.09.2025

Anzahl:

Vergleichen