« Back
Home /
ABflo® 647 Rabbit anti-Human CD26/DPP4 mAb

ABflo® 647 Rabbit anti-Human CD26/DPP4 mAb

€555.00

Excl. VAT

Item no.	A24411-500T
Manufacturer	Abclonal
Amount	500 T
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	FC
Specific against	Human (Homo sapiens)
Isotype	IgG
Conjugate/Tag	ABflo® 647. Ex:656nm. Em:670nm.
Purity	Affinity purification
Sequence	NKGTDDATADSRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNAT
NCBI	DPP4
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	DPP4; ADABP; ADCP2; CD26; DPPIV; TP103; dipeptidyl peptidase 4
Available
Background	The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides.
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 29-766 of human CD26/DPP4(NP_001926.2)
Storage	Store at 2-8℃. Avoid freeze.\|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Recommended Dilution	FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size	88kDa
Manufacturers Research Area	Cancer, Cell Biology & Developmental Biology, Ubiquitin, Endocrine & Metabolism, Immunology & Inflammation, CD markers, Stem Cells, Hematopoietic Progenitors,
Gene Symbol	DPP4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 T

Listprice: €555.00

Price: €555.00

available

Delivery expected until 9/30/2025

Quantity:

Compare