« Zurück
Startseite /
ABflo® 647 Rabbit anti-Human CD26/DPP4 mAb

ABflo® 647 Rabbit anti-Human CD26/DPP4 mAb

555,00 €

Zzgl. MwSt.

ArtNr	A24411-500T
Hersteller	Abclonal
Menge	500 T
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Monoclonal
Applikationen	FC
Specific against	Human (Homo sapiens)
Isotype	IgG
Konjugat/Tag	ABflo® 647. Ex:656nm. Em:670nm.
Purity	Affinity purification
Sequence	NKGTDDATADSRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNAT
NCBI	DPP4
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	DPP4; ADABP; ADCP2; CD26; DPPIV; TP103; dipeptidyl peptidase 4
Lieferbar
Background	The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides.
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 29-766 of human CD26/DPP4(NP_001926.2)
Storage	Store at 2-8℃. Avoid freeze.\|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Recommended Dilution	FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size	88kDa
Manufacturers Research Area	Cancer, Cell Biology & Developmental Biology, Ubiquitin, Endocrine & Metabolism, Immunology & Inflammation, CD markers, Stem Cells, Hematopoietic Progenitors,
Gene Symbol	DPP4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 T

Listenpreis: 555,00 €

Preis: 555,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen