« Back
Home /
ABflo® 594 Rabbit anti-Mouse CD8a mAb

ABflo® 594 Rabbit anti-Mouse CD8a mAb

€43.00

Excl. VAT

Item no.	A23905-100T
Manufacturer	Abclonal
Amount	100 T
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	FC
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Conjugate/Tag	ABflo® 594. Ex:594nm. Em:619nm.
Purity	Affinity purification
Sequence	KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY
NCBI	CD8A
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	Ly-2; Ly-B; Ly-35; Lyt-2
Available
Background	Enables identical protein binding activity. Acts upstream of or within several processes, including cytotoxic T cell differentiation; defense response to virus; and positive regulation of calcium-mediated signaling. Located in external side of plasma membrane. Is expressed in several structures, including endocrine gland; exocrine gland; genitourinary system; gut; and hemolymphoid system gland. Orthologous to human CD8A (CD8a molecule).
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 28-196 of mouse CD8a (NP_001074579.1).
Storage	Store at 2-8℃. Avoid freeze.\|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Recommended Dilution	FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size	27KDa
Manufacturers Research Area	Immunology, Adaptive Immunity, T Cells, Cytotoxic Cells
Gene Symbol	CD8A

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 T

Listprice: €43.00

Price: €43.00

available

Delivery expected until 9/30/2025

Quantity:

Compare